PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G143900.2
Common NamePHAVU_002G143900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 69aa    MW: 7781.08 Da    PI: 10.7449
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G143900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.61.6e-28959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        +ri+n++ rqvtfskRr+g++KKA+EL +LCda+v ++ifsstgklyey+s
  Phvul.002G143900.2  9 ERIDNSTSRQVTFSKRRKGLIKKAKELAILCDAQVGLLIFSSTGKLYEYAS 59
                        69***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.852161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.28E-28263IPR002100Transcription factor, MADS-box
CDDcd002651.59E-35263No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-28323IPR002100Transcription factor, MADS-box
PfamPF003199.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MGRGKIVIER IDNSTSRQVT FSKRRKGLIK KAKELAILCD AQVGLLIFSS TGKLYEYAST  60
RFDHHHLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A7e-20263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B7e-20263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C7e-20263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D7e-20263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150434e-82AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158335.11e-43hypothetical protein PHAVU_002G143900g
RefseqXP_007158334.11e-43hypothetical protein PHAVU_002G143900g
SwissprotQ9SZJ62e-33AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBLV7CLU31e-43V7CLU3_PHAVU; Uncharacterized protein
STRINGVIT_00s0211g00150.t014e-33(Vitis vinifera)
STRINGGLYMA09G33451.12e-32(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.11e-34AGAMOUS-like 21